I-AaeMIP

Type

Putative and/or Pseudo-Endonuclease

FASTA Sequence

Simple FASTA Numbered FASTA

Additional Information

Author: Abigail R. Lambert

Notes:
1.) Source organism: Agrocybe aegerita 2.) Host gene: mitochondrial small subunit ribosomal RNA gene 3.) Intron-encoded 4.) The protein coding sequence for this gene was synthesized and cloned into the pETCON yeast surface display vector. Upon induction, there was little to no detectable expression on the surface of the yeast. As a result, no further experiments were performed. 5.) Alternative sequence of endonuclease with mutations incorporated that are intended to increase overall solubility for in vitro studies: SQIFPINPWFITGFTDAEGSFMVSITKNENSKLKWGIYPSFAIHIHNKDISLLNQIQKTLGVGNVRKNSKTTALFRVDNLKELQVIINHFDKYPLVSFKASDYIIFKKCYNLIKQKQHLTQKGFEEILSLKYKLNKGLPDNLKKTFPHIIPIERPEYIFINIPNPYWISGFASGDSTFSVSIENSNNKLGKRVRLIFGTCLHIRDKELLIGMANYFYNSFENLNKSVLNKQNKLSDSIEHKYKYNYDSPTTSLLQIKKYSDIRDIIIPFFNKYPILGVKHQDFYDFKKISNLIDNKEHLTQDRFK

Date Added: 2012-06-25